PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1083421g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family HD-ZIP
Protein Properties Length: 751aa    MW: 80227.4 Da    PI: 6.0594
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1083421g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.42.2e-22108163156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe+lF+++++p++++r+eL+++l+L+ rqVk+WFqNrR+++k
  PDK_30s1083421g001 108 KKRYHRHTPQQIQELEALFKECPHPDEKQRQELSRRLNLEGRQVKFWFQNRRTQMK 163
                         688999***********************************************999 PP

2START162.53e-513155231189
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela++a++elvk+a+ +ep+Wv s     e ++ +e+ + f++  +     + +ea r++g+v+ ++  lve+l+d   +W  +++    +
  PDK_30s1083421g001 315 ELALAAMDELVKMAQMDEPLWVPSLegvqETLDDEEYERVFPRCIGmkpvgFVSEATRETGLVIINSSALVETLMDAT-RWADMFPcviaR 404
                         5899*********************8888777777888888777669999****************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh 161
                          +t+evissg      ++lqlm+aelq+lsplvp R++ f+R+++q  +g w++vdvS+d  +++p+     +++++lpSg+++++++ng+
  PDK_30s1083421g001 405 STTTEVISSGmggtrnATLQLMYAELQVLSPLVPvREVNFLRFCKQIAEGAWAVVDVSIDGIRENPSvPTANMKCRRLPSGCVVQDMPNGY 495
                         ******************************************************************9877889****************** PP

                         EEEEEEE-EE--SSXXHHHHHHHHHHHH CS
               START 162 skvtwvehvdlkgrlphwllrslvksgl 189
                         skvtwveh++++++ +h l+r+l++sgl
  PDK_30s1083421g001 496 SKVTWVEHAEYDEAAVHPLYRPLLRSGL 523
                         ************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.72E-2196165IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2298167IPR009057Homeodomain-like
PROSITE profilePS5007118.058105165IPR001356Homeobox domain
SMARTSM003897.1E-20106169IPR001356Homeobox domain
PfamPF000466.1E-20108163IPR001356Homeobox domain
CDDcd000866.64E-20108166No hitNo description
PROSITE patternPS000270140163IPR017970Homeobox, conserved site
PROSITE profilePS5084838.84306523IPR002913START domain
SuperFamilySSF559613.98E-27309518No hitNo description
CDDcd088756.70E-110312523No hitNo description
SMARTSM002345.4E-32315540IPR002913START domain
PfamPF018521.6E-43315522IPR002913START domain
SuperFamilySSF559612.93E-11538724No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MSFGGLFNGG SGGARPRLVS SSLSKPLLSS PGLSLALQTN MEGQGDRSLA SIVGGAAGGG  60
GYGGGGEGGR DLDAVGTHKE DENESKSGSD NLEGGSGDDI DQENPRKKKR YHRHTPQQIQ  120
ELEALFKECP HPDEKQRQEL SRRLNLEGRQ VKFWFQNRRT QMKTQMERHE NAILKQENDK  180
LRAENMSIRE AMRNPICSNC GGPAGGGVSL EEQHLRIENA RLKDELDRVC ALAGKFLGKP  240
ISALASPLPL PFLNSSLELA VGTTAFAGLG SVPMNLPVVT DFPTGASSPL GSVITPVRPI  300
GTMGGVERER TMLLELALAA MDELVKMAQM DEPLWVPSLE GVQETLDDEE YERVFPRCIG  360
MKPVGFVSEA TRETGLVIIN SSALVETLMD ATRWADMFPC VIARSTTTEV ISSGMGGTRN  420
ATLQLMYAEL QVLSPLVPVR EVNFLRFCKQ IAEGAWAVVD VSIDGIRENP SVPTANMKCR  480
RLPSGCVVQD MPNGYSKVTW VEHAEYDEAA VHPLYRPLLR SGLRPRPRGT PLAITASGRR  540
SMLKLAQRMT DNFCAGVCAS SAHKWSKLSL GNIGEDVRVM TRQSVDDPGE PPGVVLSAAT  600
SWDILSNGGP MQEMAHIAKG QDHGNAVSLL RASAVSANQS SMLILQETCT DASGSMVVYA  660
PVDIPAMHVV MNGGDSAYVA LLPSGFAILP DGGGGGGGGA HKVGGSLLTV AFQILVNSQP  720
TAKLSVESVE TVNNLISCTV QKIKAALHCD P
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795401.10.0PREDICTED: homeobox-leucine zipper protein ROC5 isoform X1
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLF6I3160.0F6I316_VITVI; Putative uncharacterized protein
STRINGVIT_15s0048g02000.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein